Anti UBN2 pAb (ATL-HPA019743)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019743-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: UBN2
Alternative Gene Name: FLJ25778, KIAA2030
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038538: 89%, ENSRNOG00000005564: 87%
Entrez Gene ID: 254048
Uniprot ID: Q6ZU65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SVTNQNVTPFGMLGGLVPVTMPFQFPLEIFGFGTDTAGVTTTSGSTSAAFHHSLTQNLLKGLQPGGAQHAATLSHSPLPAHLQQAFHDGGQSKGDTKLPRKS |
| Gene Sequence | SVTNQNVTPFGMLGGLVPVTMPFQFPLEIFGFGTDTAGVTTTSGSTSAAFHHSLTQNLLKGLQPGGAQHAATLSHSPLPAHLQQAFHDGGQSKGDTKLPRKS |
| Gene ID - Mouse | ENSMUSG00000038538 |
| Gene ID - Rat | ENSRNOG00000005564 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UBN2 pAb (ATL-HPA019743) | |
| Datasheet | Anti UBN2 pAb (ATL-HPA019743) Datasheet (External Link) |
| Vendor Page | Anti UBN2 pAb (ATL-HPA019743) at Atlas Antibodies |
| Documents & Links for Anti UBN2 pAb (ATL-HPA019743) | |
| Datasheet | Anti UBN2 pAb (ATL-HPA019743) Datasheet (External Link) |
| Vendor Page | Anti UBN2 pAb (ATL-HPA019743) |