Anti UBN1 pAb (ATL-HPA069036)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069036-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: UBN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039473: 71%, ENSRNOG00000003019: 72%
Entrez Gene ID: 29855
Uniprot ID: Q9NPG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SGTVLLAGSSLMASPYKSSSPKLSGAMSSNSLGIITPVPIPVHVLSFSADSSAKAGVSKDAIVTGPAPGSFHH |
Gene Sequence | SGTVLLAGSSLMASPYKSSSPKLSGAMSSNSLGIITPVPIPVHVLSFSADSSAKAGVSKDAIVTGPAPGSFHH |
Gene ID - Mouse | ENSMUSG00000039473 |
Gene ID - Rat | ENSRNOG00000003019 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti UBN1 pAb (ATL-HPA069036) | |
Datasheet | Anti UBN1 pAb (ATL-HPA069036) Datasheet (External Link) |
Vendor Page | Anti UBN1 pAb (ATL-HPA069036) at Atlas Antibodies |
Documents & Links for Anti UBN1 pAb (ATL-HPA069036) | |
Datasheet | Anti UBN1 pAb (ATL-HPA069036) Datasheet (External Link) |
Vendor Page | Anti UBN1 pAb (ATL-HPA069036) |