Anti UBN1 pAb (ATL-HPA061029)

Atlas Antibodies

Catalog No.:
ATL-HPA061029-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ubinuclein 1
Gene Name: UBN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039473: 73%, ENSRNOG00000003019: 75%
Entrez Gene ID: 29855
Uniprot ID: Q9NPG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKKKVMAPSKIKVKESSTKPDKKVSVPSGQIGGPIALPSDHQTGGLSIGASSRELPSQASGGLANPPPVNLEDSLDEDLIRNPASSVEA
Gene Sequence AKKKVMAPSKIKVKESSTKPDKKVSVPSGQIGGPIALPSDHQTGGLSIGASSRELPSQASGGLANPPPVNLEDSLDEDLIRNPASSVEA
Gene ID - Mouse ENSMUSG00000039473
Gene ID - Rat ENSRNOG00000003019
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBN1 pAb (ATL-HPA061029)
Datasheet Anti UBN1 pAb (ATL-HPA061029) Datasheet (External Link)
Vendor Page Anti UBN1 pAb (ATL-HPA061029) at Atlas Antibodies

Documents & Links for Anti UBN1 pAb (ATL-HPA061029)
Datasheet Anti UBN1 pAb (ATL-HPA061029) Datasheet (External Link)
Vendor Page Anti UBN1 pAb (ATL-HPA061029)