Anti UBL3 pAb (ATL-HPA058781)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058781-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: UBL3
Alternative Gene Name: DKFZP434K151, FLJ32018, HCG-1, PNSC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001687: 100%, ENSRNOG00000000921: 100%
Entrez Gene ID: 5412
Uniprot ID: O95164
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL |
Gene Sequence | LIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL |
Gene ID - Mouse | ENSMUSG00000001687 |
Gene ID - Rat | ENSRNOG00000000921 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti UBL3 pAb (ATL-HPA058781) | |
Datasheet | Anti UBL3 pAb (ATL-HPA058781) Datasheet (External Link) |
Vendor Page | Anti UBL3 pAb (ATL-HPA058781) at Atlas Antibodies |
Documents & Links for Anti UBL3 pAb (ATL-HPA058781) | |
Datasheet | Anti UBL3 pAb (ATL-HPA058781) Datasheet (External Link) |
Vendor Page | Anti UBL3 pAb (ATL-HPA058781) |