Anti UBL3 pAb (ATL-HPA058781)

Atlas Antibodies

SKU:
ATL-HPA058781-25
  • Immunohistochemical staining of human rectum shows distinct cytoplasmic positivity in endothelial cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ubiquitin-like 3
Gene Name: UBL3
Alternative Gene Name: DKFZP434K151, FLJ32018, HCG-1, PNSC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001687: 100%, ENSRNOG00000000921: 100%
Entrez Gene ID: 5412
Uniprot ID: O95164
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL
Gene Sequence LIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL
Gene ID - Mouse ENSMUSG00000001687
Gene ID - Rat ENSRNOG00000000921
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti UBL3 pAb (ATL-HPA058781)
Datasheet Anti UBL3 pAb (ATL-HPA058781) Datasheet (External Link)
Vendor Page Anti UBL3 pAb (ATL-HPA058781) at Atlas Antibodies

Documents & Links for Anti UBL3 pAb (ATL-HPA058781)
Datasheet Anti UBL3 pAb (ATL-HPA058781) Datasheet (External Link)
Vendor Page Anti UBL3 pAb (ATL-HPA058781)