Anti UBL3 pAb (ATL-HPA053772)

Atlas Antibodies

Catalog No.: ATL-HPA053772-25

Protein Description: ubiquitin-like 3
Gene Name: UBL3
Alternative Gene Name: DKFZP434K151, FLJ32018, HCG-1, PNSC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001687: 98%, ENSRNOG00000000921: 98%
Entrez Gene ID: 5412
Uniprot ID: O95164
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILR
• Gene Sequence: MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILR
• Gene ID - Mouse: ENSMUSG00000001687
• Gene ID - Rat: ENSRNOG00000000921
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.