Anti UBE4A pAb (ATL-HPA064010)

Atlas Antibodies

SKU:
ATL-HPA064010-100
  • Immunofluorescent staining of human cell line MCF7 shows localization to nuclear speckles & nucleoli fibrillar center.
  • Western blot analysis in human cell line HEL.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: ubiquitination factor E4A
Gene Name: UBE4A
Alternative Gene Name: E4, KIAA0126, UBOX2, UFD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059890: 98%, ENSRNOG00000026833: 97%
Entrez Gene ID: 9354
Uniprot ID: Q14139
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLEHVLHFITIFTGSIERMKNPHLRAKLAEVLEAVMPHLDQTPNPLVSSVFHRKRVFCNFQYAPQLAEALIKVFVDIEFTGDPHQFEQKF
Gene Sequence SLEHVLHFITIFTGSIERMKNPHLRAKLAEVLEAVMPHLDQTPNPLVSSVFHRKRVFCNFQYAPQLAEALIKVFVDIEFTGDPHQFEQKF
Gene ID - Mouse ENSMUSG00000059890
Gene ID - Rat ENSRNOG00000026833
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti UBE4A pAb (ATL-HPA064010)
Datasheet Anti UBE4A pAb (ATL-HPA064010) Datasheet (External Link)
Vendor Page Anti UBE4A pAb (ATL-HPA064010) at Atlas Antibodies

Documents & Links for Anti UBE4A pAb (ATL-HPA064010)
Datasheet Anti UBE4A pAb (ATL-HPA064010) Datasheet (External Link)
Vendor Page Anti UBE4A pAb (ATL-HPA064010)