Anti UBE4A pAb (ATL-HPA055035)

Atlas Antibodies

SKU:
ATL-HPA055035-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ubiquitination factor E4A
Gene Name: UBE4A
Alternative Gene Name: E4, KIAA0126, UBOX2, UFD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059890: 96%, ENSRNOG00000026833: 94%
Entrez Gene ID: 9354
Uniprot ID: Q14139
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKQQSDELPASPDDSDNSVSESLDEFDYSVAEISRSFRSQQEICEQLNINHMIQRIFLITLDNSDPSLKSGNGIPSRCVYLEEMAVELEDQDWLDMSNVEQALFARLLLQDPGNHLINMTSSTTLNLSADRDAGER
Gene Sequence LKQQSDELPASPDDSDNSVSESLDEFDYSVAEISRSFRSQQEICEQLNINHMIQRIFLITLDNSDPSLKSGNGIPSRCVYLEEMAVELEDQDWLDMSNVEQALFARLLLQDPGNHLINMTSSTTLNLSADRDAGER
Gene ID - Mouse ENSMUSG00000059890
Gene ID - Rat ENSRNOG00000026833
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti UBE4A pAb (ATL-HPA055035)
Datasheet Anti UBE4A pAb (ATL-HPA055035) Datasheet (External Link)
Vendor Page Anti UBE4A pAb (ATL-HPA055035) at Atlas Antibodies

Documents & Links for Anti UBE4A pAb (ATL-HPA055035)
Datasheet Anti UBE4A pAb (ATL-HPA055035) Datasheet (External Link)
Vendor Page Anti UBE4A pAb (ATL-HPA055035)