Anti UBE2V1 pAb (ATL-HPA053186)

Atlas Antibodies

Catalog No.: ATL-HPA053186-25

Protein Description: ubiquitin-conjugating enzyme E2 variant 1
Gene Name: UBE2V1
Alternative Gene Name: CROC-1, CROC1, UBE2V, UEV-1, UEV1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022674: 97%, ENSRNOG00000001829: 100%
Entrez Gene ID: 7335
Uniprot ID: Q13404
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEG
• Gene Sequence: VLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEG
• Gene ID - Mouse: ENSMUSG00000022674
• Gene ID - Rat: ENSRNOG00000001829
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.