Anti UBE2V1 pAb (ATL-HPA053186)

Atlas Antibodies

Catalog No.:
ATL-HPA053186-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ubiquitin-conjugating enzyme E2 variant 1
Gene Name: UBE2V1
Alternative Gene Name: CROC-1, CROC1, UBE2V, UEV-1, UEV1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022674: 97%, ENSRNOG00000001829: 100%
Entrez Gene ID: 7335
Uniprot ID: Q13404
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEG
Gene Sequence VLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEG
Gene ID - Mouse ENSMUSG00000022674
Gene ID - Rat ENSRNOG00000001829
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBE2V1 pAb (ATL-HPA053186)
Datasheet Anti UBE2V1 pAb (ATL-HPA053186) Datasheet (External Link)
Vendor Page Anti UBE2V1 pAb (ATL-HPA053186) at Atlas Antibodies

Documents & Links for Anti UBE2V1 pAb (ATL-HPA053186)
Datasheet Anti UBE2V1 pAb (ATL-HPA053186) Datasheet (External Link)
Vendor Page Anti UBE2V1 pAb (ATL-HPA053186)