Anti UBE2V1 pAb (ATL-HPA053186)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053186-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: UBE2V1
Alternative Gene Name: CROC-1, CROC1, UBE2V, UEV-1, UEV1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022674: 97%, ENSRNOG00000001829: 100%
Entrez Gene ID: 7335
Uniprot ID: Q13404
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEG |
Gene Sequence | VLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEG |
Gene ID - Mouse | ENSMUSG00000022674 |
Gene ID - Rat | ENSRNOG00000001829 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti UBE2V1 pAb (ATL-HPA053186) | |
Datasheet | Anti UBE2V1 pAb (ATL-HPA053186) Datasheet (External Link) |
Vendor Page | Anti UBE2V1 pAb (ATL-HPA053186) at Atlas Antibodies |
Documents & Links for Anti UBE2V1 pAb (ATL-HPA053186) | |
Datasheet | Anti UBE2V1 pAb (ATL-HPA053186) Datasheet (External Link) |
Vendor Page | Anti UBE2V1 pAb (ATL-HPA053186) |