Anti UBE2S pAb (ATL-HPA057150)

Atlas Antibodies

Catalog No.:
ATL-HPA057150-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: ubiquitin-conjugating enzyme E2S
Gene Name: UBE2S
Alternative Gene Name: E2-EPF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060860: 100%, ENSRNOG00000016930: 100%
Entrez Gene ID: 27338
Uniprot ID: Q16763
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPN
Gene Sequence MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPN
Gene ID - Mouse ENSMUSG00000060860
Gene ID - Rat ENSRNOG00000016930
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBE2S pAb (ATL-HPA057150)
Datasheet Anti UBE2S pAb (ATL-HPA057150) Datasheet (External Link)
Vendor Page Anti UBE2S pAb (ATL-HPA057150) at Atlas Antibodies

Documents & Links for Anti UBE2S pAb (ATL-HPA057150)
Datasheet Anti UBE2S pAb (ATL-HPA057150) Datasheet (External Link)
Vendor Page Anti UBE2S pAb (ATL-HPA057150)