Anti UBE2S pAb (ATL-HPA057150)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057150-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: UBE2S
Alternative Gene Name: E2-EPF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060860: 100%, ENSRNOG00000016930: 100%
Entrez Gene ID: 27338
Uniprot ID: Q16763
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPN |
Gene Sequence | MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPN |
Gene ID - Mouse | ENSMUSG00000060860 |
Gene ID - Rat | ENSRNOG00000016930 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti UBE2S pAb (ATL-HPA057150) | |
Datasheet | Anti UBE2S pAb (ATL-HPA057150) Datasheet (External Link) |
Vendor Page | Anti UBE2S pAb (ATL-HPA057150) at Atlas Antibodies |
Documents & Links for Anti UBE2S pAb (ATL-HPA057150) | |
Datasheet | Anti UBE2S pAb (ATL-HPA057150) Datasheet (External Link) |
Vendor Page | Anti UBE2S pAb (ATL-HPA057150) |