Anti UBE2M pAb (ATL-HPA054551 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054551-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: UBE2M
Alternative Gene Name: hUbc12, UBC12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005575: 100%, ENSRNOG00000027514: 100%
Entrez Gene ID: 9040
Uniprot ID: P61081
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK |
| Gene Sequence | LEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK |
| Gene ID - Mouse | ENSMUSG00000005575 |
| Gene ID - Rat | ENSRNOG00000027514 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UBE2M pAb (ATL-HPA054551 w/enhanced validation) | |
| Datasheet | Anti UBE2M pAb (ATL-HPA054551 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti UBE2M pAb (ATL-HPA054551 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti UBE2M pAb (ATL-HPA054551 w/enhanced validation) | |
| Datasheet | Anti UBE2M pAb (ATL-HPA054551 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti UBE2M pAb (ATL-HPA054551 w/enhanced validation) |