Anti UBE2L3 pAb (ATL-HPA062415)

Atlas Antibodies

Catalog No.:
ATL-HPA062415-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: ubiquitin conjugating enzyme E2 L3
Gene Name: UBE2L3
Alternative Gene Name: UBCH7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038965: 100%, ENSRNOG00000030467: 51%
Entrez Gene ID: 7332
Uniprot ID: P68036
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
Gene Sequence CLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
Gene ID - Mouse ENSMUSG00000038965
Gene ID - Rat ENSRNOG00000030467
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBE2L3 pAb (ATL-HPA062415)
Datasheet Anti UBE2L3 pAb (ATL-HPA062415) Datasheet (External Link)
Vendor Page Anti UBE2L3 pAb (ATL-HPA062415) at Atlas Antibodies

Documents & Links for Anti UBE2L3 pAb (ATL-HPA062415)
Datasheet Anti UBE2L3 pAb (ATL-HPA062415) Datasheet (External Link)
Vendor Page Anti UBE2L3 pAb (ATL-HPA062415)