Anti UBE2G1 pAb (ATL-HPA050551)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050551-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: UBE2G1
Alternative Gene Name: UBC7, UBE2G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020794: 100%, ENSRNOG00000010041: 100%
Entrez Gene ID: 7326
Uniprot ID: P62253
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVA |
Gene Sequence | RWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVA |
Gene ID - Mouse | ENSMUSG00000020794 |
Gene ID - Rat | ENSRNOG00000010041 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti UBE2G1 pAb (ATL-HPA050551) | |
Datasheet | Anti UBE2G1 pAb (ATL-HPA050551) Datasheet (External Link) |
Vendor Page | Anti UBE2G1 pAb (ATL-HPA050551) at Atlas Antibodies |
Documents & Links for Anti UBE2G1 pAb (ATL-HPA050551) | |
Datasheet | Anti UBE2G1 pAb (ATL-HPA050551) Datasheet (External Link) |
Vendor Page | Anti UBE2G1 pAb (ATL-HPA050551) |