Anti UBE2D2 pAb (ATL-HPA003920)

Atlas Antibodies

Catalog No.: ATL-HPA003920-100

Protein Description: ubiquitin-conjugating enzyme E2D 2
Gene Name: UBE2D2
Alternative Gene Name: UBC4, UbcH5B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078578: 95%, ENSRNOG00000013741: 95%
Entrez Gene ID: 7322
Uniprot ID: P62837
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRS
• Gene Sequence: LTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRS
• Gene ID - Mouse: ENSMUSG00000078578
• Gene ID - Rat: ENSRNOG00000013741
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.