Anti UBE2C pAb (ATL-HPA054975)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054975-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: UBE2C
Alternative Gene Name: UBCH10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001403: 98%, ENSRNOG00000015131: 100%
Entrez Gene ID: 11065
Uniprot ID: O00762
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVD |
| Gene Sequence | GPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVD |
| Gene ID - Mouse | ENSMUSG00000001403 |
| Gene ID - Rat | ENSRNOG00000015131 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UBE2C pAb (ATL-HPA054975) | |
| Datasheet | Anti UBE2C pAb (ATL-HPA054975) Datasheet (External Link) |
| Vendor Page | Anti UBE2C pAb (ATL-HPA054975) at Atlas Antibodies |
| Documents & Links for Anti UBE2C pAb (ATL-HPA054975) | |
| Datasheet | Anti UBE2C pAb (ATL-HPA054975) Datasheet (External Link) |
| Vendor Page | Anti UBE2C pAb (ATL-HPA054975) |
| Citations for Anti UBE2C pAb (ATL-HPA054975) – 1 Found |
| Shen, Peilin; He, Xuejun; Lan, Lin; Hong, Yingkai; Lin, Mingen. Identification of cell division cycle 20 as a candidate biomarker and potential therapeutic target in bladder cancer using bioinformatics analysis. Bioscience Reports. 2020;40(7) PubMed |