Anti UBE2A pAb (ATL-HPA051765)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051765-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: UBE2A
Alternative Gene Name: HHR6A, RAD6A, UBC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016308: 100%, ENSRNOG00000039985: 100%
Entrez Gene ID: 7319
Uniprot ID: P49459
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSW |
Gene Sequence | IQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSW |
Gene ID - Mouse | ENSMUSG00000016308 |
Gene ID - Rat | ENSRNOG00000039985 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti UBE2A pAb (ATL-HPA051765) | |
Datasheet | Anti UBE2A pAb (ATL-HPA051765) Datasheet (External Link) |
Vendor Page | Anti UBE2A pAb (ATL-HPA051765) at Atlas Antibodies |
Documents & Links for Anti UBE2A pAb (ATL-HPA051765) | |
Datasheet | Anti UBE2A pAb (ATL-HPA051765) Datasheet (External Link) |
Vendor Page | Anti UBE2A pAb (ATL-HPA051765) |