Anti UBE2A pAb (ATL-HPA051765)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051765-25
- Shipping:
- Calculated at Checkout
        
            
        
        
        $447.00
    
         
                            Gene Name: UBE2A
Alternative Gene Name: HHR6A, RAD6A, UBC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016308: 100%, ENSRNOG00000039985: 100%
Entrez Gene ID: 7319
Uniprot ID: P49459
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | IQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSW | 
| Gene Sequence | IQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSW | 
| Gene ID - Mouse | ENSMUSG00000016308 | 
| Gene ID - Rat | ENSRNOG00000039985 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti UBE2A pAb (ATL-HPA051765) | |
| Datasheet | Anti UBE2A pAb (ATL-HPA051765) Datasheet (External Link) | 
| Vendor Page | Anti UBE2A pAb (ATL-HPA051765) at Atlas Antibodies | 
| Documents & Links for Anti UBE2A pAb (ATL-HPA051765) | |
| Datasheet | Anti UBE2A pAb (ATL-HPA051765) Datasheet (External Link) | 
| Vendor Page | Anti UBE2A pAb (ATL-HPA051765) | 
 
         
                             
                                        