Anti UBE2A pAb (ATL-HPA051765)

Atlas Antibodies

Catalog No.:
ATL-HPA051765-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ubiquitin-conjugating enzyme E2A
Gene Name: UBE2A
Alternative Gene Name: HHR6A, RAD6A, UBC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016308: 100%, ENSRNOG00000039985: 100%
Entrez Gene ID: 7319
Uniprot ID: P49459
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSW
Gene Sequence IQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSW
Gene ID - Mouse ENSMUSG00000016308
Gene ID - Rat ENSRNOG00000039985
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBE2A pAb (ATL-HPA051765)
Datasheet Anti UBE2A pAb (ATL-HPA051765) Datasheet (External Link)
Vendor Page Anti UBE2A pAb (ATL-HPA051765) at Atlas Antibodies

Documents & Links for Anti UBE2A pAb (ATL-HPA051765)
Datasheet Anti UBE2A pAb (ATL-HPA051765) Datasheet (External Link)
Vendor Page Anti UBE2A pAb (ATL-HPA051765)