Anti UBB pAb (ATL-HPA049132)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049132-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: UBB
Alternative Gene Name: FLJ25987, MGC8385
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019505: 100%, ENSRNOG00000057823: 100%
Entrez Gene ID: 7314
Uniprot ID: P0CG47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG |
| Gene Sequence | GMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG |
| Gene ID - Mouse | ENSMUSG00000019505 |
| Gene ID - Rat | ENSRNOG00000057823 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UBB pAb (ATL-HPA049132) | |
| Datasheet | Anti UBB pAb (ATL-HPA049132) Datasheet (External Link) |
| Vendor Page | Anti UBB pAb (ATL-HPA049132) at Atlas Antibodies |
| Documents & Links for Anti UBB pAb (ATL-HPA049132) | |
| Datasheet | Anti UBB pAb (ATL-HPA049132) Datasheet (External Link) |
| Vendor Page | Anti UBB pAb (ATL-HPA049132) |
| Citations for Anti UBB pAb (ATL-HPA049132) – 1 Found |
| Guo, Yi-Nan; Dong, Hao; Ma, Fu-Chao; Huang, Jing-Jv; Liang, Kai-Zhi; Peng, Jia-Li; Chen, Gang; Wei, Kang-Lai. The clinicopathological significance of decreased miR-125b-5p in hepatocellular carcinoma: evidence based on RT-qPCR, microRNA-microarray, and microRNA-sequencing. International Journal Of Clinical And Experimental Pathology. 12(1):21-39. PubMed |