Anti UBALD1 pAb (ATL-HPA066771)

Atlas Antibodies

SKU:
ATL-HPA066771-25
  • Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: UBA-like domain containing 1
Gene Name: UBALD1
Alternative Gene Name: FAM100A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039568: 87%, ENSRNOG00000046295: 89%
Entrez Gene ID: 124402
Uniprot ID: Q8TB05
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MFSRLKASESFHSGGSGSPMAATATSPPPHFPHAATSSSAASSWPTAASPPGGPQHHQPQPPLWTPTPPSPASDWPPLAPQQATSEPRAHPAMEAER
Gene Sequence MFSRLKASESFHSGGSGSPMAATATSPPPHFPHAATSSSAASSWPTAASPPGGPQHHQPQPPLWTPTPPSPASDWPPLAPQQATSEPRAHPAMEAER
Gene ID - Mouse ENSMUSG00000039568
Gene ID - Rat ENSRNOG00000046295
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti UBALD1 pAb (ATL-HPA066771)
Datasheet Anti UBALD1 pAb (ATL-HPA066771) Datasheet (External Link)
Vendor Page Anti UBALD1 pAb (ATL-HPA066771) at Atlas Antibodies

Documents & Links for Anti UBALD1 pAb (ATL-HPA066771)
Datasheet Anti UBALD1 pAb (ATL-HPA066771) Datasheet (External Link)
Vendor Page Anti UBALD1 pAb (ATL-HPA066771)