Anti UBA7 pAb (ATL-HPA058182)

Atlas Antibodies

SKU: ATL-HPA058182-25

• 

Protein Description: ubiquitin-like modifier activating enzyme 7
Gene Name: UBA7
Alternative Gene Name: D8, UBA1B, UBE1L, UBE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032596: 81%, ENSRNOG00000029195: 74%
Entrez Gene ID: 7318
Uniprot ID: P41226
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVKRPKTVRHKSLDTALLQPHVVAQSSQEVHHAHCLHQAFCALHKFQHLHGRPPQPWDPVDAETVVGLARDLEPLKR
• Gene Sequence: EVKRPKTVRHKSLDTALLQPHVVAQSSQEVHHAHCLHQAFCALHKFQHLHGRPPQPWDPVDAETVVGLARDLEPLKR
• Gene ID - Mouse: ENSMUSG00000032596
• Gene ID - Rat: ENSRNOG00000029195
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.