Anti UBA3 pAb (ATL-HPA065335 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA065335-25
  • Immunohistochemistry analysis in human skin and pancreas tissues using Anti-UBA3 antibody. Corresponding UBA3 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm, plasma membrane & centrosome.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ubiquitin-like modifier activating enzyme 3
Gene Name: UBA3
Alternative Gene Name: hUba3, NAE2, UBE1C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030061: 100%, ENSRNOG00000006221: 100%
Entrez Gene ID: 9039
Uniprot ID: Q8TBC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLE
Gene Sequence VVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLE
Gene ID - Mouse ENSMUSG00000030061
Gene ID - Rat ENSRNOG00000006221
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti UBA3 pAb (ATL-HPA065335 w/enhanced validation)
Datasheet Anti UBA3 pAb (ATL-HPA065335 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti UBA3 pAb (ATL-HPA065335 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti UBA3 pAb (ATL-HPA065335 w/enhanced validation)
Datasheet Anti UBA3 pAb (ATL-HPA065335 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti UBA3 pAb (ATL-HPA065335 w/enhanced validation)