Anti UACA pAb (ATL-HPA056006)

Atlas Antibodies

Catalog No.:
ATL-HPA056006-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: uveal autoantigen with coiled-coil domains and ankyrin repeats
Gene Name: UACA
Alternative Gene Name: FLJ10128, KIAA1561
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034485: 61%, ENSRNOG00000012868: 60%
Entrez Gene ID: 55075
Uniprot ID: Q9BZF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTLNDTLAKTNRELLDVKKKFEDINQEFVKIKDKNEILKRNLENTQNQIKAEYISLAEHEAKMSSLSQSMRKVQDSNAEILANYRKGQEEIVTLHAEIKAQKK
Gene Sequence MTLNDTLAKTNRELLDVKKKFEDINQEFVKIKDKNEILKRNLENTQNQIKAEYISLAEHEAKMSSLSQSMRKVQDSNAEILANYRKGQEEIVTLHAEIKAQKK
Gene ID - Mouse ENSMUSG00000034485
Gene ID - Rat ENSRNOG00000012868
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UACA pAb (ATL-HPA056006)
Datasheet Anti UACA pAb (ATL-HPA056006) Datasheet (External Link)
Vendor Page Anti UACA pAb (ATL-HPA056006) at Atlas Antibodies

Documents & Links for Anti UACA pAb (ATL-HPA056006)
Datasheet Anti UACA pAb (ATL-HPA056006) Datasheet (External Link)
Vendor Page Anti UACA pAb (ATL-HPA056006)