Anti U2SURP pAb (ATL-HPA061407 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA061407-25

• 

Protein Description: U2 snRNP-associated SURP domain containing
Gene Name: U2SURP
Alternative Gene Name: fSAPa, SR140
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032407: 100%, ENSRNOG00000008607: 100%
Entrez Gene ID: 23350
Uniprot ID: O15042
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSILQGDSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMS
• Gene Sequence: IEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSILQGDSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMS
• Gene ID - Mouse: ENSMUSG00000032407
• Gene ID - Rat: ENSRNOG00000008607
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.