Anti U2SURP pAb (ATL-HPA061407 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA061407-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: U2 snRNP-associated SURP domain containing
Gene Name: U2SURP
Alternative Gene Name: fSAPa, SR140
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032407: 100%, ENSRNOG00000008607: 100%
Entrez Gene ID: 23350
Uniprot ID: O15042
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSILQGDSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMS
Gene Sequence IEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSILQGDSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMS
Gene ID - Mouse ENSMUSG00000032407
Gene ID - Rat ENSRNOG00000008607
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti U2SURP pAb (ATL-HPA061407 w/enhanced validation)
Datasheet Anti U2SURP pAb (ATL-HPA061407 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti U2SURP pAb (ATL-HPA061407 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti U2SURP pAb (ATL-HPA061407 w/enhanced validation)
Datasheet Anti U2SURP pAb (ATL-HPA061407 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti U2SURP pAb (ATL-HPA061407 w/enhanced validation)