Anti U2AF2 pAb (ATL-HPA043562 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043562-100
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: U2AF2
Alternative Gene Name: U2AF65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030435: 100%, ENSRNOG00000015914: 98%
Entrez Gene ID: 11338
Uniprot ID: P26368
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVS |
| Gene Sequence | PDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVS |
| Gene ID - Mouse | ENSMUSG00000030435 |
| Gene ID - Rat | ENSRNOG00000015914 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti U2AF2 pAb (ATL-HPA043562 w/enhanced validation) | |
| Datasheet | Anti U2AF2 pAb (ATL-HPA043562 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti U2AF2 pAb (ATL-HPA043562 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti U2AF2 pAb (ATL-HPA043562 w/enhanced validation) | |
| Datasheet | Anti U2AF2 pAb (ATL-HPA043562 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti U2AF2 pAb (ATL-HPA043562 w/enhanced validation) |