Anti U2AF2 pAb (ATL-HPA041943)

Atlas Antibodies

Catalog No.:
ATL-HPA041943-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: U2 small nuclear RNA auxiliary factor 2
Gene Name: U2AF2
Alternative Gene Name: U2AF65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030435: 100%, ENSRNOG00000015914: 100%
Entrez Gene ID: 11338
Uniprot ID: P26368
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEA
Gene Sequence LTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEA
Gene ID - Mouse ENSMUSG00000030435
Gene ID - Rat ENSRNOG00000015914
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti U2AF2 pAb (ATL-HPA041943)
Datasheet Anti U2AF2 pAb (ATL-HPA041943) Datasheet (External Link)
Vendor Page Anti U2AF2 pAb (ATL-HPA041943) at Atlas Antibodies

Documents & Links for Anti U2AF2 pAb (ATL-HPA041943)
Datasheet Anti U2AF2 pAb (ATL-HPA041943) Datasheet (External Link)
Vendor Page Anti U2AF2 pAb (ATL-HPA041943)