Anti U2AF1L4 pAb (ATL-HPA061644)

Atlas Antibodies

Catalog No.:
ATL-HPA061644-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: U2 small nuclear RNA auxiliary factor 1-like 4
Gene Name: U2AF1L4
Alternative Gene Name: MGC33901, U2AF1L3, U2af26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025366: 33%, ENSRNOG00000060753: 32%
Entrez Gene ID: 199746
Uniprot ID: Q8WU68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKP
Gene Sequence PRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKP
Gene ID - Mouse ENSMUSG00000025366
Gene ID - Rat ENSRNOG00000060753
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti U2AF1L4 pAb (ATL-HPA061644)
Datasheet Anti U2AF1L4 pAb (ATL-HPA061644) Datasheet (External Link)
Vendor Page Anti U2AF1L4 pAb (ATL-HPA061644) at Atlas Antibodies

Documents & Links for Anti U2AF1L4 pAb (ATL-HPA061644)
Datasheet Anti U2AF1L4 pAb (ATL-HPA061644) Datasheet (External Link)
Vendor Page Anti U2AF1L4 pAb (ATL-HPA061644)