Anti TYSND1 pAb (ATL-HPA030304)

Atlas Antibodies

Catalog No.: ATL-HPA030304-25

Protein Description: trypsin domain containing 1
Gene Name: TYSND1
Alternative Gene Name: MGC34695, NET41
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020087: 86%, ENSRNOG00000024839: 86%
Entrez Gene ID: 219743
Uniprot ID: Q2T9J0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATQETCPYDIAVVSLEEDLDDVPIPVPAEHFHEGEAVSVVGFGVFGQSCGPSVTSGILSAVVQVNGTPVMLQTTCAV
• Gene Sequence: ATQETCPYDIAVVSLEEDLDDVPIPVPAEHFHEGEAVSVVGFGVFGQSCGPSVTSGILSAVVQVNGTPVMLQTTCAV
• Gene ID - Mouse: ENSMUSG00000020087
• Gene ID - Rat: ENSRNOG00000024839
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.