Anti TYR pAb (ATL-HPA050889)

Atlas Antibodies

Catalog No.:
ATL-HPA050889-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: tyrosinase
Gene Name: TYR
Alternative Gene Name: OCA1, OCA1A, OCAIA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004651: 64%, ENSRNOG00000016421: 70%
Entrez Gene ID: 7299
Uniprot ID: P14679
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLCRHKRKQLPEEKQPLLMEKEDYHSLYQSHL
Gene Sequence LLCRHKRKQLPEEKQPLLMEKEDYHSLYQSHL
Gene ID - Mouse ENSMUSG00000004651
Gene ID - Rat ENSRNOG00000016421
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TYR pAb (ATL-HPA050889)
Datasheet Anti TYR pAb (ATL-HPA050889) Datasheet (External Link)
Vendor Page Anti TYR pAb (ATL-HPA050889) at Atlas Antibodies

Documents & Links for Anti TYR pAb (ATL-HPA050889)
Datasheet Anti TYR pAb (ATL-HPA050889) Datasheet (External Link)
Vendor Page Anti TYR pAb (ATL-HPA050889)