Anti TYR pAb (ATL-HPA050889)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050889-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: TYR
Alternative Gene Name: OCA1, OCA1A, OCAIA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004651: 64%, ENSRNOG00000016421: 70%
Entrez Gene ID: 7299
Uniprot ID: P14679
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLCRHKRKQLPEEKQPLLMEKEDYHSLYQSHL |
| Gene Sequence | LLCRHKRKQLPEEKQPLLMEKEDYHSLYQSHL |
| Gene ID - Mouse | ENSMUSG00000004651 |
| Gene ID - Rat | ENSRNOG00000016421 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TYR pAb (ATL-HPA050889) | |
| Datasheet | Anti TYR pAb (ATL-HPA050889) Datasheet (External Link) |
| Vendor Page | Anti TYR pAb (ATL-HPA050889) at Atlas Antibodies |
| Documents & Links for Anti TYR pAb (ATL-HPA050889) | |
| Datasheet | Anti TYR pAb (ATL-HPA050889) Datasheet (External Link) |
| Vendor Page | Anti TYR pAb (ATL-HPA050889) |