Anti TXNRD3NB pAb (ATL-HPA058257)

Atlas Antibodies

SKU:
ATL-HPA058257-25
  • Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in subset of hematopoietic cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: thioredoxin reductase 3 neighbor
Gene Name: TXNRD3NB
Alternative Gene Name: TR2IT1, TXNRD3IT1, TXNRD3NT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040690: 30%, ENSRNOG00000031475: 30%
Entrez Gene ID:
Uniprot ID: Q6F5E7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSLEHGDKVFGQGFPSPLEEIKRLLKISRALQARSVPSTQEKAKCLSGEPGQPEGKGQETYPGPGKVEGKAEPAMRKDDVCP
Gene Sequence SSLEHGDKVFGQGFPSPLEEIKRLLKISRALQARSVPSTQEKAKCLSGEPGQPEGKGQETYPGPGKVEGKAEPAMRKDDVCP
Gene ID - Mouse ENSMUSG00000040690
Gene ID - Rat ENSRNOG00000031475
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TXNRD3NB pAb (ATL-HPA058257)
Datasheet Anti TXNRD3NB pAb (ATL-HPA058257) Datasheet (External Link)
Vendor Page Anti TXNRD3NB pAb (ATL-HPA058257) at Atlas Antibodies

Documents & Links for Anti TXNRD3NB pAb (ATL-HPA058257)
Datasheet Anti TXNRD3NB pAb (ATL-HPA058257) Datasheet (External Link)
Vendor Page Anti TXNRD3NB pAb (ATL-HPA058257)