Anti TXLNB pAb (ATL-HPA030401 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA030401-25

Protein Description: taxilin beta
Gene Name: TXLNB
Alternative Gene Name: C6orf198, dJ522B19.2, DKFZp451A175, MDP77
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021910: 38%, ENSRNOG00000060021: 39%
Entrez Gene ID: 167838
Uniprot ID: Q8N3L3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPLTPQAEAEGGSDAEPPSKASNSPAGLGAETQCEGLPVGAQADQASWKPEAEASGQAPQAPTEASLQKMEADVPAPACAAEEHVAAM
• Gene Sequence: PPLTPQAEAEGGSDAEPPSKASNSPAGLGAETQCEGLPVGAQADQASWKPEAEASGQAPQAPTEASLQKMEADVPAPACAAEEHVAAM
• Gene ID - Mouse: ENSMUSG00000021910
• Gene ID - Rat: ENSRNOG00000060021
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.