Anti TWNK pAb (ATL-HPA002532)

Atlas Antibodies

Catalog No.:
ATL-HPA002532-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: twinkle mtDNA helicase
Gene Name: TWNK
Alternative Gene Name: C10orf2, FLJ21832, IOSCA, PEO, PEO1, TWINKLE, TWINL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025209: 80%, ENSRNOG00000014935: 78%
Entrez Gene ID: 56652
Uniprot ID: Q96RR1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKAPEFEDSEEVRRIWNRAIPLWELPDQEEVQLADTMFGLTKVTDDTLKRFSVRYLRPARSLVFPWFSPGGSGLRGLKLLEAKCQGDGVSYEETTIPRPSAYHNLFGLPLISRRDAEVVLTSRELDSLALNQSTG
Gene Sequence SKAPEFEDSEEVRRIWNRAIPLWELPDQEEVQLADTMFGLTKVTDDTLKRFSVRYLRPARSLVFPWFSPGGSGLRGLKLLEAKCQGDGVSYEETTIPRPSAYHNLFGLPLISRRDAEVVLTSRELDSLALNQSTG
Gene ID - Mouse ENSMUSG00000025209
Gene ID - Rat ENSRNOG00000014935
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TWNK pAb (ATL-HPA002532)
Datasheet Anti TWNK pAb (ATL-HPA002532) Datasheet (External Link)
Vendor Page Anti TWNK pAb (ATL-HPA002532) at Atlas Antibodies

Documents & Links for Anti TWNK pAb (ATL-HPA002532)
Datasheet Anti TWNK pAb (ATL-HPA002532) Datasheet (External Link)
Vendor Page Anti TWNK pAb (ATL-HPA002532)
Citations for Anti TWNK pAb (ATL-HPA002532) – 1 Found
Peeva, Viktoriya; Blei, Daniel; Trombly, Genevieve; Corsi, Sarah; Szukszto, Maciej J; Rebelo-Guiomar, Pedro; Gammage, Payam A; Kudin, Alexei P; Becker, Christian; Altmüller, Janine; Minczuk, Michal; Zsurka, Gábor; Kunz, Wolfram S. Linear mitochondrial DNA is rapidly degraded by components of the replication machinery. Nature Communications. 2018;9(1):1727.  PubMed