Anti TVP23C pAb (ATL-HPA065603)

Atlas Antibodies

Catalog No.: ATL-HPA065603-25

Protein Description: trans-golgi network vesicle protein 23 homolog C (S. cerevisiae)
Gene Name: TVP23C
Alternative Gene Name: FAM18B2, MGC8763
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014177: 93%, ENSRNOG00000050649: 87%
Entrez Gene ID: 201158
Uniprot ID: Q96ET8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLQQDSNDDTEDVSLFDAEEETTNRPRKAK
• Gene Sequence: MLQQDSNDDTEDVSLFDAEEETTNRPRKAK
• Gene ID - Mouse: ENSMUSG00000014177
• Gene ID - Rat: ENSRNOG00000050649
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.