Anti TVP23C pAb (ATL-HPA065603)

Atlas Antibodies

Catalog No.:
ATL-HPA065603-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: trans-golgi network vesicle protein 23 homolog C (S. cerevisiae)
Gene Name: TVP23C
Alternative Gene Name: FAM18B2, MGC8763
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014177: 93%, ENSRNOG00000050649: 87%
Entrez Gene ID: 201158
Uniprot ID: Q96ET8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLQQDSNDDTEDVSLFDAEEETTNRPRKAK
Gene Sequence MLQQDSNDDTEDVSLFDAEEETTNRPRKAK
Gene ID - Mouse ENSMUSG00000014177
Gene ID - Rat ENSRNOG00000050649
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TVP23C pAb (ATL-HPA065603)
Datasheet Anti TVP23C pAb (ATL-HPA065603) Datasheet (External Link)
Vendor Page Anti TVP23C pAb (ATL-HPA065603) at Atlas Antibodies

Documents & Links for Anti TVP23C pAb (ATL-HPA065603)
Datasheet Anti TVP23C pAb (ATL-HPA065603) Datasheet (External Link)
Vendor Page Anti TVP23C pAb (ATL-HPA065603)