Anti TVP23A pAb (ATL-HPA060582)

Atlas Antibodies

Catalog No.:
ATL-HPA060582-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: trans-golgi network vesicle protein 23 homolog A (S. cerevisiae)
Gene Name: TVP23A
Alternative Gene Name: FAM18A, YDR084C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050908: 73%, ENSRNOG00000025545: 71%
Entrez Gene ID: 780776
Uniprot ID: A6NH52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILCKMGGNSDIGKVTASFLSQTVFQTACPGDFQKPGLEGLEIHQH
Gene Sequence ILCKMGGNSDIGKVTASFLSQTVFQTACPGDFQKPGLEGLEIHQH
Gene ID - Mouse ENSMUSG00000050908
Gene ID - Rat ENSRNOG00000025545
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TVP23A pAb (ATL-HPA060582)
Datasheet Anti TVP23A pAb (ATL-HPA060582) Datasheet (External Link)
Vendor Page Anti TVP23A pAb (ATL-HPA060582) at Atlas Antibodies

Documents & Links for Anti TVP23A pAb (ATL-HPA060582)
Datasheet Anti TVP23A pAb (ATL-HPA060582) Datasheet (External Link)
Vendor Page Anti TVP23A pAb (ATL-HPA060582)