Anti TUT1 pAb (ATL-HPA071838)

Atlas Antibodies

Catalog No.:
ATL-HPA071838-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: terminal uridylyl transferase 1, U6 snRNA-specific
Gene Name: TUT1
Alternative Gene Name: FLJ21850, FLJ22267, FLJ22347, PAPD2, RBM21, TUTase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071645: 81%, ENSRNOG00000020047: 80%
Entrez Gene ID: 64852
Uniprot ID: Q9H6E5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LASPQSLPPASPLLEDREEGDLGKASELAETPKEEKAEGAAMLELVGSILRGCVPGVYRVQTVPSARRPVVKFCHRPSGLHGD
Gene Sequence LASPQSLPPASPLLEDREEGDLGKASELAETPKEEKAEGAAMLELVGSILRGCVPGVYRVQTVPSARRPVVKFCHRPSGLHGD
Gene ID - Mouse ENSMUSG00000071645
Gene ID - Rat ENSRNOG00000020047
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TUT1 pAb (ATL-HPA071838)
Datasheet Anti TUT1 pAb (ATL-HPA071838) Datasheet (External Link)
Vendor Page Anti TUT1 pAb (ATL-HPA071838) at Atlas Antibodies

Documents & Links for Anti TUT1 pAb (ATL-HPA071838)
Datasheet Anti TUT1 pAb (ATL-HPA071838) Datasheet (External Link)
Vendor Page Anti TUT1 pAb (ATL-HPA071838)