Anti TUT1 pAb (ATL-HPA069055)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069055-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TUT1
Alternative Gene Name: FLJ21850, FLJ22267, FLJ22347, PAPD2, RBM21, TUTase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071645: 69%, ENSRNOG00000020047: 67%
Entrez Gene ID: 64852
Uniprot ID: Q9H6E5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GWLATEAQVTQELKGLSGGEERPETEPLLSFVASVSPADRMLTVTPLQDPQGLFPDLHHFLQVFLPQAIR |
| Gene Sequence | GWLATEAQVTQELKGLSGGEERPETEPLLSFVASVSPADRMLTVTPLQDPQGLFPDLHHFLQVFLPQAIR |
| Gene ID - Mouse | ENSMUSG00000071645 |
| Gene ID - Rat | ENSRNOG00000020047 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TUT1 pAb (ATL-HPA069055) | |
| Datasheet | Anti TUT1 pAb (ATL-HPA069055) Datasheet (External Link) |
| Vendor Page | Anti TUT1 pAb (ATL-HPA069055) at Atlas Antibodies |
| Documents & Links for Anti TUT1 pAb (ATL-HPA069055) | |
| Datasheet | Anti TUT1 pAb (ATL-HPA069055) Datasheet (External Link) |
| Vendor Page | Anti TUT1 pAb (ATL-HPA069055) |