Anti TUSC3 pAb (ATL-HPA049974)

Atlas Antibodies

Catalog No.: ATL-HPA049974-25

Protein Description: tumor suppressor candidate 3
Gene Name: TUSC3
Alternative Gene Name: MGC13453, MRT7, N33, OST3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039530: 97%, ENSRNOG00000013061: 97%
Entrez Gene ID: 7991
Uniprot ID: Q13454
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GQKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFI
• Gene Sequence: GQKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFI
• Gene ID - Mouse: ENSMUSG00000039530
• Gene ID - Rat: ENSRNOG00000013061
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.