Anti TUSC1 pAb (ATL-HPA051426)

Atlas Antibodies

Catalog No.: ATL-HPA051426-25

Protein Description: tumor suppressor candidate 1
Gene Name: TUSC1
Alternative Gene Name: TSG-9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054000: 70%, ENSRNOG00000018997: 33%
Entrez Gene ID: 286319
Uniprot ID: Q2TAM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TNRRARDSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPLQEPDSGLRSRDSEPS
• Gene Sequence: TNRRARDSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPLQEPDSGLRSRDSEPS
• Gene ID - Mouse: ENSMUSG00000054000
• Gene ID - Rat: ENSRNOG00000018997
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.