Anti TUSC1 pAb (ATL-HPA051426)

Atlas Antibodies

Catalog No.:
ATL-HPA051426-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: tumor suppressor candidate 1
Gene Name: TUSC1
Alternative Gene Name: TSG-9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054000: 70%, ENSRNOG00000018997: 33%
Entrez Gene ID: 286319
Uniprot ID: Q2TAM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TNRRARDSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPLQEPDSGLRSRDSEPS
Gene Sequence TNRRARDSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPLQEPDSGLRSRDSEPS
Gene ID - Mouse ENSMUSG00000054000
Gene ID - Rat ENSRNOG00000018997
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TUSC1 pAb (ATL-HPA051426)
Datasheet Anti TUSC1 pAb (ATL-HPA051426) Datasheet (External Link)
Vendor Page Anti TUSC1 pAb (ATL-HPA051426) at Atlas Antibodies

Documents & Links for Anti TUSC1 pAb (ATL-HPA051426)
Datasheet Anti TUSC1 pAb (ATL-HPA051426) Datasheet (External Link)
Vendor Page Anti TUSC1 pAb (ATL-HPA051426)