Anti TUBGCP5 pAb (ATL-HPA040366)

Atlas Antibodies

Catalog No.:
ATL-HPA040366-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tubulin, gamma complex associated protein 5
Gene Name: TUBGCP5
Alternative Gene Name: GCP5, KIAA1899
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033790: 85%, ENSRNOG00000011480: 87%
Entrez Gene ID: 114791
Uniprot ID: Q96RT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLYTLFLESVQSRLRHGEDSTPQVLTEQQATKENLMKMQSIAESHLELDDVHDPLLAINFARMYLEQSDFHEKFAGGDVCVDRSSESVTCQTFELTLRSC
Gene Sequence SLYTLFLESVQSRLRHGEDSTPQVLTEQQATKENLMKMQSIAESHLELDDVHDPLLAINFARMYLEQSDFHEKFAGGDVCVDRSSESVTCQTFELTLRSC
Gene ID - Mouse ENSMUSG00000033790
Gene ID - Rat ENSRNOG00000011480
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TUBGCP5 pAb (ATL-HPA040366)
Datasheet Anti TUBGCP5 pAb (ATL-HPA040366) Datasheet (External Link)
Vendor Page Anti TUBGCP5 pAb (ATL-HPA040366) at Atlas Antibodies

Documents & Links for Anti TUBGCP5 pAb (ATL-HPA040366)
Datasheet Anti TUBGCP5 pAb (ATL-HPA040366) Datasheet (External Link)
Vendor Page Anti TUBGCP5 pAb (ATL-HPA040366)