Anti TUB pAb (ATL-HPA049019)

Atlas Antibodies

Catalog No.:
ATL-HPA049019-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: tubby bipartite transcription factor
Gene Name: TUB
Alternative Gene Name: rd5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090035: 27%, ENSRNOG00000007850: 28%
Entrez Gene ID: 7275
Uniprot ID: P50607
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPSFWVSFFAETGILFPGGTPWPMGSQHSKQHRKPGPLKRGHRRDRRTTRRKYWKEGREI
Gene Sequence LPSFWVSFFAETGILFPGGTPWPMGSQHSKQHRKPGPLKRGHRRDRRTTRRKYWKEGREI
Gene ID - Mouse ENSMUSG00000090035
Gene ID - Rat ENSRNOG00000007850
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TUB pAb (ATL-HPA049019)
Datasheet Anti TUB pAb (ATL-HPA049019) Datasheet (External Link)
Vendor Page Anti TUB pAb (ATL-HPA049019) at Atlas Antibodies

Documents & Links for Anti TUB pAb (ATL-HPA049019)
Datasheet Anti TUB pAb (ATL-HPA049019) Datasheet (External Link)
Vendor Page Anti TUB pAb (ATL-HPA049019)