Anti TUB pAb (ATL-HPA049019)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049019-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TUB
Alternative Gene Name: rd5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090035: 27%, ENSRNOG00000007850: 28%
Entrez Gene ID: 7275
Uniprot ID: P50607
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LPSFWVSFFAETGILFPGGTPWPMGSQHSKQHRKPGPLKRGHRRDRRTTRRKYWKEGREI |
Gene Sequence | LPSFWVSFFAETGILFPGGTPWPMGSQHSKQHRKPGPLKRGHRRDRRTTRRKYWKEGREI |
Gene ID - Mouse | ENSMUSG00000090035 |
Gene ID - Rat | ENSRNOG00000007850 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TUB pAb (ATL-HPA049019) | |
Datasheet | Anti TUB pAb (ATL-HPA049019) Datasheet (External Link) |
Vendor Page | Anti TUB pAb (ATL-HPA049019) at Atlas Antibodies |
Documents & Links for Anti TUB pAb (ATL-HPA049019) | |
Datasheet | Anti TUB pAb (ATL-HPA049019) Datasheet (External Link) |
Vendor Page | Anti TUB pAb (ATL-HPA049019) |