Anti TTYH3 pAb (ATL-HPA053520)

Atlas Antibodies

Catalog No.:
ATL-HPA053520-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tweety family member 3
Gene Name: TTYH3
Alternative Gene Name: KIAA1691
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036565: 94%, ENSRNOG00000055583: 94%
Entrez Gene ID: 80727
Uniprot ID: Q9C0H2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PWWVSLLHRLPHFDLSWEATSSQFRPEDTDYQQ
Gene Sequence PWWVSLLHRLPHFDLSWEATSSQFRPEDTDYQQ
Gene ID - Mouse ENSMUSG00000036565
Gene ID - Rat ENSRNOG00000055583
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TTYH3 pAb (ATL-HPA053520)
Datasheet Anti TTYH3 pAb (ATL-HPA053520) Datasheet (External Link)
Vendor Page Anti TTYH3 pAb (ATL-HPA053520) at Atlas Antibodies

Documents & Links for Anti TTYH3 pAb (ATL-HPA053520)
Datasheet Anti TTYH3 pAb (ATL-HPA053520) Datasheet (External Link)
Vendor Page Anti TTYH3 pAb (ATL-HPA053520)