Anti TTLL7 pAb (ATL-HPA052249)

Atlas Antibodies

Catalog No.:
ATL-HPA052249-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: tubulin tyrosine ligase-like family, member 7
Gene Name: TTLL7
Alternative Gene Name: FLJ23033
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036745: 62%, ENSRNOG00000031997: 61%
Entrez Gene ID: 79739
Uniprot ID: Q6ZT98
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEYQNKKREKQVTYNLKPSNHYKLIQQPSSIRRSVSCPRSISAQSPSSGDTRPFSAQQMISVSRPTSASRS
Gene Sequence EEYQNKKREKQVTYNLKPSNHYKLIQQPSSIRRSVSCPRSISAQSPSSGDTRPFSAQQMISVSRPTSASRS
Gene ID - Mouse ENSMUSG00000036745
Gene ID - Rat ENSRNOG00000031997
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TTLL7 pAb (ATL-HPA052249)
Datasheet Anti TTLL7 pAb (ATL-HPA052249) Datasheet (External Link)
Vendor Page Anti TTLL7 pAb (ATL-HPA052249) at Atlas Antibodies

Documents & Links for Anti TTLL7 pAb (ATL-HPA052249)
Datasheet Anti TTLL7 pAb (ATL-HPA052249) Datasheet (External Link)
Vendor Page Anti TTLL7 pAb (ATL-HPA052249)