Anti TTLL4 pAb (ATL-HPA027091)

Atlas Antibodies

Catalog No.: ATL-HPA027091-25

Protein Description: tubulin tyrosine ligase-like family, member 4
Gene Name: TTLL4
Alternative Gene Name: KIAA0173
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033257: 89%, ENSRNOG00000017129: 89%
Entrez Gene ID: 9654
Uniprot ID: Q14679
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DGLEDCCSRDENEEEEGDSECSSLSAVSPSESVAMISRSCMEILTKPLSNHEKVVRPALIYSLFPNVPPTIYFGTRDERVEKLPWEQRKLLRWKMSTVTPNIVKQTIGRSHFKISKRNDDWLGCWGHHMKSPSFRSI
• Gene Sequence: DGLEDCCSRDENEEEEGDSECSSLSAVSPSESVAMISRSCMEILTKPLSNHEKVVRPALIYSLFPNVPPTIYFGTRDERVEKLPWEQRKLLRWKMSTVTPNIVKQTIGRSHFKISKRNDDWLGCWGHHMKSPSFRSI
• Gene ID - Mouse: ENSMUSG00000033257
• Gene ID - Rat: ENSRNOG00000017129
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.