Anti TTLL3 pAb (ATL-HPA051413)

Atlas Antibodies

Catalog No.:
ATL-HPA051413-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tubulin tyrosine ligase-like family, member 3
Gene Name: TTLL3
Alternative Gene Name: DKFZP434B103, HOTTL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030276: 46%, ENSRNOG00000026065: 26%
Entrez Gene ID: 26140
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLVGTKALSTTGKALRTLPTAKVFISLPPNLDFKVAPSILKPRKAPALLCLRGPQLEVPCCLCPLKSEQFLAPV
Gene Sequence KLVGTKALSTTGKALRTLPTAKVFISLPPNLDFKVAPSILKPRKAPALLCLRGPQLEVPCCLCPLKSEQFLAPV
Gene ID - Mouse ENSMUSG00000030276
Gene ID - Rat ENSRNOG00000026065
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TTLL3 pAb (ATL-HPA051413)
Datasheet Anti TTLL3 pAb (ATL-HPA051413) Datasheet (External Link)
Vendor Page Anti TTLL3 pAb (ATL-HPA051413) at Atlas Antibodies

Documents & Links for Anti TTLL3 pAb (ATL-HPA051413)
Datasheet Anti TTLL3 pAb (ATL-HPA051413) Datasheet (External Link)
Vendor Page Anti TTLL3 pAb (ATL-HPA051413)