Anti TTLL3 pAb (ATL-HPA051413)

Atlas Antibodies

Catalog No.: ATL-HPA051413-25

Protein Description: tubulin tyrosine ligase-like family, member 3
Gene Name: TTLL3
Alternative Gene Name: DKFZP434B103, HOTTL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030276: 46%, ENSRNOG00000026065: 26%
Entrez Gene ID: 26140
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLVGTKALSTTGKALRTLPTAKVFISLPPNLDFKVAPSILKPRKAPALLCLRGPQLEVPCCLCPLKSEQFLAPV
• Gene Sequence: KLVGTKALSTTGKALRTLPTAKVFISLPPNLDFKVAPSILKPRKAPALLCLRGPQLEVPCCLCPLKSEQFLAPV
• Gene ID - Mouse: ENSMUSG00000030276
• Gene ID - Rat: ENSRNOG00000026065
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.