Anti TTLL1 pAb (ATL-HPA048392)

Atlas Antibodies

Catalog No.:
ATL-HPA048392-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tubulin tyrosine ligase-like family, member 1
Gene Name: TTLL1
Alternative Gene Name: C22orf7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022442: 93%, ENSRNOG00000010141: 93%
Entrez Gene ID: 25809
Uniprot ID: O95922
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLTSSTANDRILKYNLINDTLNIAVPNGEIPDCKWNKSPPKEVLGNYEILYDEELAQGDGADRELRSRQGQSLGPRAGRSRDSGRAVLTTWK
Gene Sequence SLTSSTANDRILKYNLINDTLNIAVPNGEIPDCKWNKSPPKEVLGNYEILYDEELAQGDGADRELRSRQGQSLGPRAGRSRDSGRAVLTTWK
Gene ID - Mouse ENSMUSG00000022442
Gene ID - Rat ENSRNOG00000010141
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TTLL1 pAb (ATL-HPA048392)
Datasheet Anti TTLL1 pAb (ATL-HPA048392) Datasheet (External Link)
Vendor Page Anti TTLL1 pAb (ATL-HPA048392) at Atlas Antibodies

Documents & Links for Anti TTLL1 pAb (ATL-HPA048392)
Datasheet Anti TTLL1 pAb (ATL-HPA048392) Datasheet (External Link)
Vendor Page Anti TTLL1 pAb (ATL-HPA048392)