Anti TTF2 pAb (ATL-HPA070762)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070762-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TTF2
Alternative Gene Name: HuF2, ZGRF6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033222: 61%, ENSRNOG00000057761: 24%
Entrez Gene ID: 8458
Uniprot ID: Q9UNY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VELQGLLLPQDKKEYRLFFRCIRSKAEGKRWCGSIPWQDPDSKEHSVSNKSQHASETFHHSSNWLRNPFKVLDKNQEPALWKQLIKGE |
Gene Sequence | VELQGLLLPQDKKEYRLFFRCIRSKAEGKRWCGSIPWQDPDSKEHSVSNKSQHASETFHHSSNWLRNPFKVLDKNQEPALWKQLIKGE |
Gene ID - Mouse | ENSMUSG00000033222 |
Gene ID - Rat | ENSRNOG00000057761 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TTF2 pAb (ATL-HPA070762) | |
Datasheet | Anti TTF2 pAb (ATL-HPA070762) Datasheet (External Link) |
Vendor Page | Anti TTF2 pAb (ATL-HPA070762) at Atlas Antibodies |
Documents & Links for Anti TTF2 pAb (ATL-HPA070762) | |
Datasheet | Anti TTF2 pAb (ATL-HPA070762) Datasheet (External Link) |
Vendor Page | Anti TTF2 pAb (ATL-HPA070762) |