Anti TTF1 pAb (ATL-HPA054837)

Atlas Antibodies

Catalog No.:
ATL-HPA054837-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transcription termination factor, RNA polymerase I
Gene Name: TTF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026803: 44%, ENSRNOG00000039777: 44%
Entrez Gene ID: 7270
Uniprot ID: Q15361
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VKRARVSGDDFSVPSKNSESTLFDSVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPANEEHNVETAEDSEIRYLSADSGDADDSDADLGSAV
Gene Sequence VKRARVSGDDFSVPSKNSESTLFDSVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPANEEHNVETAEDSEIRYLSADSGDADDSDADLGSAV
Gene ID - Mouse ENSMUSG00000026803
Gene ID - Rat ENSRNOG00000039777
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TTF1 pAb (ATL-HPA054837)
Datasheet Anti TTF1 pAb (ATL-HPA054837) Datasheet (External Link)
Vendor Page Anti TTF1 pAb (ATL-HPA054837) at Atlas Antibodies

Documents & Links for Anti TTF1 pAb (ATL-HPA054837)
Datasheet Anti TTF1 pAb (ATL-HPA054837) Datasheet (External Link)
Vendor Page Anti TTF1 pAb (ATL-HPA054837)
Citations for Anti TTF1 pAb (ATL-HPA054837) – 1 Found
Zheng, Limei; Yan, Xiaorong; Hu, Chengcong; Zhang, Peng; Chen, Yupeng; Zheng, Qiaoyan; Hu, Liwen; Wang, Mi; Li, Guoping; Wu, Ping; Jiang, Changzhen; Tian, Jing; Zhang, Sheng; Wang, Xingfu. Observation of Clinicopathologic Features of Pituitary Adenoma With Neuronal Differentiation. Frontiers In Endocrinology. 13( 35370935):848762.  PubMed