Anti TTF1 pAb (ATL-HPA054837)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054837-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TTF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026803: 44%, ENSRNOG00000039777: 44%
Entrez Gene ID: 7270
Uniprot ID: Q15361
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VKRARVSGDDFSVPSKNSESTLFDSVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPANEEHNVETAEDSEIRYLSADSGDADDSDADLGSAV |
| Gene Sequence | VKRARVSGDDFSVPSKNSESTLFDSVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPANEEHNVETAEDSEIRYLSADSGDADDSDADLGSAV |
| Gene ID - Mouse | ENSMUSG00000026803 |
| Gene ID - Rat | ENSRNOG00000039777 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TTF1 pAb (ATL-HPA054837) | |
| Datasheet | Anti TTF1 pAb (ATL-HPA054837) Datasheet (External Link) |
| Vendor Page | Anti TTF1 pAb (ATL-HPA054837) at Atlas Antibodies |
| Documents & Links for Anti TTF1 pAb (ATL-HPA054837) | |
| Datasheet | Anti TTF1 pAb (ATL-HPA054837) Datasheet (External Link) |
| Vendor Page | Anti TTF1 pAb (ATL-HPA054837) |
| Citations for Anti TTF1 pAb (ATL-HPA054837) – 1 Found |
| Zheng, Limei; Yan, Xiaorong; Hu, Chengcong; Zhang, Peng; Chen, Yupeng; Zheng, Qiaoyan; Hu, Liwen; Wang, Mi; Li, Guoping; Wu, Ping; Jiang, Changzhen; Tian, Jing; Zhang, Sheng; Wang, Xingfu. Observation of Clinicopathologic Features of Pituitary Adenoma With Neuronal Differentiation. Frontiers In Endocrinology. 13( 35370935):848762. PubMed |