Anti TTC6 pAb (ATL-HPA069293)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069293-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TTC6
Alternative Gene Name: C14orf25, NCRNA00291
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046782: 70%, ENSRNOG00000016105: 30%
Entrez Gene ID: 319089
Uniprot ID: Q86TZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQALDL |
| Gene Sequence | NEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQALDL |
| Gene ID - Mouse | ENSMUSG00000046782 |
| Gene ID - Rat | ENSRNOG00000016105 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TTC6 pAb (ATL-HPA069293) | |
| Datasheet | Anti TTC6 pAb (ATL-HPA069293) Datasheet (External Link) |
| Vendor Page | Anti TTC6 pAb (ATL-HPA069293) at Atlas Antibodies |
| Documents & Links for Anti TTC6 pAb (ATL-HPA069293) | |
| Datasheet | Anti TTC6 pAb (ATL-HPA069293) Datasheet (External Link) |
| Vendor Page | Anti TTC6 pAb (ATL-HPA069293) |