Anti TTC6 pAb (ATL-HPA069293)

Atlas Antibodies

Catalog No.:
ATL-HPA069293-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: tetratricopeptide repeat domain 6
Gene Name: TTC6
Alternative Gene Name: C14orf25, NCRNA00291
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046782: 70%, ENSRNOG00000016105: 30%
Entrez Gene ID: 319089
Uniprot ID: Q86TZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQALDL
Gene Sequence NEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQALDL
Gene ID - Mouse ENSMUSG00000046782
Gene ID - Rat ENSRNOG00000016105
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TTC6 pAb (ATL-HPA069293)
Datasheet Anti TTC6 pAb (ATL-HPA069293) Datasheet (External Link)
Vendor Page Anti TTC6 pAb (ATL-HPA069293) at Atlas Antibodies

Documents & Links for Anti TTC6 pAb (ATL-HPA069293)
Datasheet Anti TTC6 pAb (ATL-HPA069293) Datasheet (External Link)
Vendor Page Anti TTC6 pAb (ATL-HPA069293)