Anti TTC5 pAb (ATL-HPA054198)

Atlas Antibodies

Catalog No.:
ATL-HPA054198-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: tetratricopeptide repeat domain 5
Gene Name: TTC5
Alternative Gene Name: Strap
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006288: 93%, ENSRNOG00000008850: 94%
Entrez Gene ID: 91875
Uniprot ID: Q8N0Z6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TFGLVDSDGPCYAVMVYNIVQSWGVLIGDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNGKPQGSSSQAVATVASRPQC
Gene Sequence TFGLVDSDGPCYAVMVYNIVQSWGVLIGDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNGKPQGSSSQAVATVASRPQC
Gene ID - Mouse ENSMUSG00000006288
Gene ID - Rat ENSRNOG00000008850
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TTC5 pAb (ATL-HPA054198)
Datasheet Anti TTC5 pAb (ATL-HPA054198) Datasheet (External Link)
Vendor Page Anti TTC5 pAb (ATL-HPA054198) at Atlas Antibodies

Documents & Links for Anti TTC5 pAb (ATL-HPA054198)
Datasheet Anti TTC5 pAb (ATL-HPA054198) Datasheet (External Link)
Vendor Page Anti TTC5 pAb (ATL-HPA054198)