Anti TTC39C pAb (ATL-HPA065713)

Atlas Antibodies

SKU:
ATL-HPA065713-25
  • Immunohistochemical staining of human stomach shows moderate nuclear membranous positivity in glandular cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: tetratricopeptide repeat domain 39C
Gene Name: TTC39C
Alternative Gene Name: C18orf17, FLJ33761, HsT2697
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024424: 98%, ENSRNOG00000050949: 98%
Entrez Gene ID: 125488
Uniprot ID: Q8N584
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSFHTALELAVDQREIQHVCLYEIGWCSMIELNFKDAFDSFERLKNESRWSQCYYAYLTAVCQGATGDVDGAQIVFKEVQKLFKRKNNQIEQFSV
Gene Sequence TSFHTALELAVDQREIQHVCLYEIGWCSMIELNFKDAFDSFERLKNESRWSQCYYAYLTAVCQGATGDVDGAQIVFKEVQKLFKRKNNQIEQFSV
Gene ID - Mouse ENSMUSG00000024424
Gene ID - Rat ENSRNOG00000050949
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TTC39C pAb (ATL-HPA065713)
Datasheet Anti TTC39C pAb (ATL-HPA065713) Datasheet (External Link)
Vendor Page Anti TTC39C pAb (ATL-HPA065713) at Atlas Antibodies

Documents & Links for Anti TTC39C pAb (ATL-HPA065713)
Datasheet Anti TTC39C pAb (ATL-HPA065713) Datasheet (External Link)
Vendor Page Anti TTC39C pAb (ATL-HPA065713)