Anti TTC39C pAb (ATL-HPA065705)

Atlas Antibodies

SKU:
ATL-HPA065705-25
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: tetratricopeptide repeat domain 39C
Gene Name: TTC39C
Alternative Gene Name: C18orf17, FLJ33761, HsT2697
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024424: 98%, ENSRNOG00000050949: 96%
Entrez Gene ID: 125488
Uniprot ID: Q8N584
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen INMLLNNGFRESDQLFKQYRNHSPLMSFGASFVSFLNAMMTFEEEKMQLACDDLKTTEKLCESEEAGVIETIKNKIKKNVDVRKSAPSMVDRLQ
Gene Sequence INMLLNNGFRESDQLFKQYRNHSPLMSFGASFVSFLNAMMTFEEEKMQLACDDLKTTEKLCESEEAGVIETIKNKIKKNVDVRKSAPSMVDRLQ
Gene ID - Mouse ENSMUSG00000024424
Gene ID - Rat ENSRNOG00000050949
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TTC39C pAb (ATL-HPA065705)
Datasheet Anti TTC39C pAb (ATL-HPA065705) Datasheet (External Link)
Vendor Page Anti TTC39C pAb (ATL-HPA065705) at Atlas Antibodies

Documents & Links for Anti TTC39C pAb (ATL-HPA065705)
Datasheet Anti TTC39C pAb (ATL-HPA065705) Datasheet (External Link)
Vendor Page Anti TTC39C pAb (ATL-HPA065705)