Anti TTC39B pAb (ATL-HPA063162)

Atlas Antibodies

SKU:
ATL-HPA063162-25
  • Immunofluorescent staining of human cell line Hep G2 shows localization to endoplasmic reticulum.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: tetratricopeptide repeat domain 39B
Gene Name: TTC39B
Alternative Gene Name: C9orf52, FLJ33868
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038172: 92%, ENSRNOG00000042603: 91%
Entrez Gene ID: 158219
Uniprot ID: Q5VTQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSSSTKVDLKSGLEECAVALNLFLSNKFTDALELLRPWAKESMYHALGYSTIVVLQAVLTFEQQDIQNGISAMKDALQ
Gene Sequence SSSSTKVDLKSGLEECAVALNLFLSNKFTDALELLRPWAKESMYHALGYSTIVVLQAVLTFEQQDIQNGISAMKDALQ
Gene ID - Mouse ENSMUSG00000038172
Gene ID - Rat ENSRNOG00000042603
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TTC39B pAb (ATL-HPA063162)
Datasheet Anti TTC39B pAb (ATL-HPA063162) Datasheet (External Link)
Vendor Page Anti TTC39B pAb (ATL-HPA063162) at Atlas Antibodies

Documents & Links for Anti TTC39B pAb (ATL-HPA063162)
Datasheet Anti TTC39B pAb (ATL-HPA063162) Datasheet (External Link)
Vendor Page Anti TTC39B pAb (ATL-HPA063162)