Anti TTC25 pAb (ATL-HPA023908 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA023908-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tetratricopeptide repeat domain 25
Gene Name: TTC25
Alternative Gene Name: DKFZP434H0115
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006784: 88%, ENSRNOG00000017473: 91%
Entrez Gene ID: 83538
Uniprot ID: Q96NG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STFPSYMAEGERLYLCGEFSKAAQSFSNALYLQDGDKNCLVARSKCFLKMGDLERSLKDAEASLQSDPAFCKGILQKAETLYTMGDFE
Gene Sequence STFPSYMAEGERLYLCGEFSKAAQSFSNALYLQDGDKNCLVARSKCFLKMGDLERSLKDAEASLQSDPAFCKGILQKAETLYTMGDFE
Gene ID - Mouse ENSMUSG00000006784
Gene ID - Rat ENSRNOG00000017473
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TTC25 pAb (ATL-HPA023908 w/enhanced validation)
Datasheet Anti TTC25 pAb (ATL-HPA023908 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TTC25 pAb (ATL-HPA023908 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TTC25 pAb (ATL-HPA023908 w/enhanced validation)
Datasheet Anti TTC25 pAb (ATL-HPA023908 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TTC25 pAb (ATL-HPA023908 w/enhanced validation)
Citations for Anti TTC25 pAb (ATL-HPA023908 w/enhanced validation) – 1 Found
Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535)  PubMed