Anti TTC25 pAb (ATL-HPA023908 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023908-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TTC25
Alternative Gene Name: DKFZP434H0115
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006784: 88%, ENSRNOG00000017473: 91%
Entrez Gene ID: 83538
Uniprot ID: Q96NG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | STFPSYMAEGERLYLCGEFSKAAQSFSNALYLQDGDKNCLVARSKCFLKMGDLERSLKDAEASLQSDPAFCKGILQKAETLYTMGDFE |
| Gene Sequence | STFPSYMAEGERLYLCGEFSKAAQSFSNALYLQDGDKNCLVARSKCFLKMGDLERSLKDAEASLQSDPAFCKGILQKAETLYTMGDFE |
| Gene ID - Mouse | ENSMUSG00000006784 |
| Gene ID - Rat | ENSRNOG00000017473 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TTC25 pAb (ATL-HPA023908 w/enhanced validation) | |
| Datasheet | Anti TTC25 pAb (ATL-HPA023908 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TTC25 pAb (ATL-HPA023908 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti TTC25 pAb (ATL-HPA023908 w/enhanced validation) | |
| Datasheet | Anti TTC25 pAb (ATL-HPA023908 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TTC25 pAb (ATL-HPA023908 w/enhanced validation) |
| Citations for Anti TTC25 pAb (ATL-HPA023908 w/enhanced validation) – 1 Found |
| Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535) PubMed |